Sermorelin — 5 mg
$49.99
Buy Sermorelin — 5 mg — 5 mg lyophilized research peptide at >99% HPLC purity, third-party tested with Certificate of Analysis on request. Ships same business day from Canada via Canada Post Xpresspost, tracked worldwide delivery. Commonly ordered alongside IGF-1 LR3 — 1 mg. Supplied strictly for laboratory research use — not for human consumption.
Discount per Quantity
| Quantity | 5 – 9 | 10 + |
|---|---|---|
| Discount | 5% | 10% |
| Price | $47.49 | $44.99 |
Orders over $200: FREE Canada Post Priority shipping.
- >99% purity — HPLC + MS verified
- Cold-pack insulated mailers
- Discreet Canadian shipping (2–5 days)
- COA available on request
Research Use Only. Not for human consumption. Sold strictly for laboratory and research use.
Buy Sermorelin — 5 mg in Canada — Research Peptide, Ships From Canada
Buy Sermorelin — 5 mg direct from Peptides Canada — a >99% HPLC-verified research peptide, supplied as a lyophilized solid sealed in a borosilicate glass vial and ready for laboratory use on arrival. Every batch is independently tested by HPLC and mass spectrometry, every unit is labelled with its lot number, and a full Certificate of Analysis is available on request before or after purchase. Orders placed before the daily cut-off ship the same business day from our Canadian facility via Canada Post Xpresspost, with tracked, discreet delivery available across Canada in 1–2 business days and to research laboratories worldwide. Researchers who order Sermorelin — 5 mg commonly bench it alongside IGF-1 LR3 — 1 mg in parallel protocols. Sermorelin — 5 mg is sold strictly for in-vitro laboratory research use only — it is not a medicine, not a supplement, and not intended for human or veterinary consumption under any circumstances.
What is Sermorelin — 5 mg?
Sermorelin — 5 mg is a synthetic GHRH(1-29) fragment. The peptide is manufactured by solid-phase peptide synthesis, purified by preparative reversed-phase HPLC, and released to sale only after passing our acceptance criteria of >99% purity and correct molecular mass by mass spectrometry. Published research on this compound traces back to Wehrenberg et al., 1980s; historical clinical use, and it is referenced in the laboratory literature for GHRH-receptor and pituitary GH-release research. We hold Sermorelin — 5 mg in permanent Canadian stock so laboratory orders are never blocked by supplier backorder, and every dispatched unit is traceable to a retained reference sample kept for a minimum of twelve months.
Product specifications
- Product: Sermorelin — 5 mg
- Presentation: 5 mg per unit (lyophilized solid sealed in a borosilicate glass vial)
- Molecular weight: 3358.9 g/mol
- Molecular formula: C149H246N44O42S
- CAS number: 86168-78-7
- Sequence / structure: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Compound class: synthetic GHRH(1-29) fragment
- Purity: >99% by HPLC (COA per batch)
- Appearance: White to off-white lyophilized powder
- Container: Sealed borosilicate glass vial with crimped seal
- Storage: −20 °C long-term; 2–8 °C after reconstitution, use within 30 days
- Intended use: Laboratory research only — not for human or veterinary use
Research context and mechanism
Sermorelin — 5 mg is classified as a synthetic GHRH(1-29) fragment in the peer-reviewed literature. It is investigated in preclinical models focused on GHRH-receptor and pituitary GH-release research. The reference source most commonly cited for identification and characterisation of this compound is Wehrenberg et al., 1980s; historical clinical use. Every batch we release is manufactured to a specification consistent with these published reference materials, and the batch Certificate of Analysis lists the exact HPLC purity, molecular mass by MS, and identification method used for release testing so it can be cross-referenced against the published literature by the receiving laboratory.
Quality, purity and third-party testing
Every lot of Sermorelin — 5 mg is verified by reversed-phase HPLC at >99% purity and confirmed for correct molecular weight by mass spectrometry. We retain a reference sample from each batch for a minimum of twelve months and can supply the corresponding Certificate of Analysis on request — simply reply to your order confirmation with the batch number printed on the label. Purity is not a marketing figure for us; it is the acceptance criterion. Anything that fails is rejected, not relabelled, and third-party audit trails are retained for every dispatched lot.
Documentation and compliance
Sermorelin — 5 mg ships with the paperwork a Canadian or international laboratory needs to log the item into a research inventory: a printed label carrying the batch number, an order confirmation carrying the lot reference, and a batch Certificate of Analysis available on request through the same order-reply channel. For laboratories operating under quality-management or GLP frameworks, we can supply supplementary documentation — including safety data, provenance statements and identity confirmation by mass spectrometry — on request. This transparency is why Canadian universities, private research groups and biotechnology laboratories return to Peptides Canada as their default supplier for research peptides in Canadian stock.
Reconstitution and handling
Reconstitute the lyophilized Sermorelin — 5 mg powder with bacteriostatic water for injection inside a laminar flow cabinet or equivalent controlled environment. Add the diluent slowly against the vial wall, then allow the peptide to dissolve without vigorous shaking — gentle inversion is sufficient. Once reconstituted, store the vial at 2–8 °C, protected from light, and use within thirty days. Laboratories reconstituting Sermorelin — 5 mg typically order supporting consumables such as our Pfizer Bacteriostatic Water — 30 mL in the same delivery to keep bench workflows uninterrupted.
Why Canadian researchers buy Sermorelin — 5 mg from Peptides Canada
- Canadian stock, no waiting: Every unit ships from our Canadian facility — no cross-border drop-shipping delays for Canadian customers.
- >99% HPLC purity, third-party verified: Batch COA available on request; retention samples held for full traceability.
- Same-business-day dispatch: Orders placed before the daily cut-off leave the same business day.
- Canada Post Xpresspost: Tracked delivery across Canada in 1–2 business days.
- Safe worldwide shipping: Fully tracked international delivery to research laboratories with tamper-evident sealing and temperature-appropriate packaging.
- Discreet, unbranded packaging: Plain outer packaging with no product references on the label.
- Canadian support: Real researchers answering technical and order questions from a Canadian inbox.
Shipping — Canada and worldwide
Canadian orders are dispatched by Canada Post Xpresspost, delivered tracked in 1–2 business days to most Canadian addresses. Worldwide orders ship by tracked international courier or Xpresspost International, depending on destination — every parcel receives an end-to-end tracking number that we email at dispatch. Units are cushioned inside a rigid mailer, sealed with tamper-evident tape, and packed in discreet outer packaging with no product name visible on the exterior. International customers are responsible for local import duties and for confirming that receipt of research chemicals is permitted at the destination address before ordering. We ship worldwide from our Canadian facility every business day and provide replacement or refund cover on any parcel confirmed lost in transit by the tracked carrier.
Research use only — important notice
Sermorelin — 5 mg is sold exclusively as a reference material for licensed laboratory research and analytical use. It is not a Natural Health Product, not a drug, not a food supplement, not a cosmetic, and has not been approved for human or veterinary use by Health Canada, the FDA, the EMA or any comparable regulator. It must not be administered to humans or animals, ingested, injected, inhaled, or applied to the body under any circumstances. By placing an order you confirm that you are a qualified researcher or research organisation, that the material will be handled under appropriate laboratory conditions with correct personal protective equipment, and that it will be used solely for legitimate in-vitro or analytical research. Purchases in breach of this restriction are prohibited and orders that appear to be for personal use may be cancelled at our discretion.
FAQ
How pure is your Sermorelin — 5 mg? Every batch is >99% by HPLC, confirmed by mass spectrometry, with the exact figure printed on the Certificate of Analysis for that lot.
How is it shipped in Canada? By Canada Post Xpresspost with end-to-end tracking, delivered in 1–2 business days to most Canadian postal codes.
Do you ship worldwide? Yes — we ship discreetly and tracked from Canada to research laboratories worldwide, with every parcel packed to withstand international transit.
How should I store it before reconstitution? Sealed at −20 °C, protected from light. Short-term storage at 2–8 °C is acceptable, but −20 °C preserves the peptide for the longest shelf life.
What do researchers commonly order alongside Sermorelin — 5 mg? Laboratories running comparative bench workflows often add PT-141 — 10 mg to the same order for parallel protocols.
Can I request a Certificate of Analysis? Yes — reply to your order confirmation with the batch number on the label and we will email the COA the same business day.
Research use only. Not for human or veterinary consumption. Handle under good laboratory practice with appropriate PPE.
| SKU | sermorelin-canada |
|---|---|
| Category | Growth & Anti-Aging |
| Purity | >99% (HPLC + MS verified) |
| Form | Lyophilized powder |
| Origin | Dispatched from Canada |
Certificate of Analysis
Every lot is verified by reverse-phase HPLC for purity and by mass spectrometry for identity. A current COA is available on request — email sales@peptides-canada.ca with the lot number printed on your vial.
- HPLC purity: >99%
- Identity confirmed by ESI-MS
- Lyophilized, sterile-filtered solutions where applicable
- Stored at −20°C until shipment
Shipping & handling
Orders placed before 2pm ET ship the same business day in cold-pack insulated mailers. Canada Post Priority delivery in 2–5 business days. Free shipping on Canadian orders over $200.
Frequently asked questions
How should I reconstitute this peptide?
Use bacteriostatic water for short-term lab storage. Direct the diluent down the side of the vial, swirl gently — do not shake.
What is the shelf life?
Lyophilized peptide stored at −20°C is stable for 24+ months. Reconstituted peptide should be refrigerated and used within 2–4 weeks.
Do you ship internationally?
We currently ship within Canada only. International researchers should contact our bulk team for institutional quotes.
Frequently bought together

Reviews
There are no reviews yet.